Mouse Anti-TMEM88B Antibody (CBMOAB-60648FYA)


Cat: CBMOAB-60648FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60648FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO60648FYA 100 µg
CBMOAB-10037FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO10037FYB 100 µg
MO-AB-66558W Monoclonal Marmoset WB, ELISA MO66558W 100 µg
MO-AB-21912R Monoclonal Cattle (Bos taurus) WB, ELISA MO21912R 100 µg
MO-AB-29633H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29633C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO60648FYA
SpecificityThis antibody binds to Rhesus TMEM88B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM88B Antibody is a mouse antibody against TMEM88B. It can be used for TMEM88B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 88B; TMEM88B
UniProt IDH9FDQ1
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: GPPDHQASALPCPGWPGPLLLPGRLVAGLLLHLLLPATAFLLVLLPAAAVVYLGFLCHSRVHPAPGPRCRALFSDRGSAALIVFGLLSLPPLLVLASAVRARLARRLRPLLPPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry