Mouse Anti-TMEM92 Antibody (CBMOAB-60657FYA)


Cat: CBMOAB-60657FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60657FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO60657FYA 100 µg
MO-AB-21917R Monoclonal Cattle (Bos taurus) WB, ELISA MO21917R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO60657FYA
SpecificityThis antibody binds to Rhesus TMEM92.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM92 Antibody is a mouse antibody against TMEM92. It can be used for TMEM92 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM92
UniProt IDF7BJU8
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: MSQAWVTGLAPTLLLSLLASPQKVAAKCGFIFNCPKGFKCCGDSCCQENELFPGPVRIFVIIFLVILSLFCICGLAKCFCRNCREPEPDAPMDCPGPLELPSIIPPERVRVSPSAPPPPYSEVILKPSLGPTPTEPPPPYSFRPEEYTGDRRGIDNPAF.
For Research Use Only | Not For Clinical Use.
Online Inquiry