AibGenesis™ Mouse Anti-TMEM95 Antibody (CBMOAB-60658FYA)


Cat: CBMOAB-60658FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60658FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO60658FYA 100 µg
MO-AB-29638H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29638C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO60658FYA
SpecificityThis antibody binds to Rhesus TMEM95.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM95 Antibody is a mouse antibody against TMEM95. It can be used for TMEM95 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM95
UniProt IDF7HLM7
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MWRLALGGVFLAAAQACVFCRLPAHDLSGRLARLCSRMETRQKECGASPDFSAFALDEVSMNKVTEKTHRVLRVMEIKEALSSLPSYWSWLRKIKLPKYTREALCPPACPLPLLSPAGGSTTLYNCSTCKGMEVSCWPRKRCFPGSQDLWEAKILLLSVFGAVLLLGVLSLLVESHHLQAKSGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry