Mouse Anti-TMPRSS11F Antibody (CBMOAB-60675FYA)


Cat: CBMOAB-60675FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60675FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO60675FYA 100 µg
MO-AB-07364W Monoclonal Cat (Felis catus) WB, ELISA MO07364W 100 µg
MO-AB-10254Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10254Y 100 µg
MO-AB-21934R Monoclonal Cattle (Bos taurus) WB, ELISA MO21934R 100 µg
MO-AB-46860W Monoclonal Horse (Equus caballus) WB, ELISA MO46860W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus)
CloneMO60675FYA
SpecificityThis antibody binds to Rhesus TMPRSS11F.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMPRSS11F Antibody is a mouse antibody against TMPRSS11F. It can be used for TMPRSS11F detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMPRSS11F
UniProt IDF6WP76
Protein RefseqThe length of the protein is 438 amino acids long.
The sequence is show below: MMYAPVEFSEAEFSRLEYQRKQQFWDSVRLALFTLAIVAIIGIAIGIVTHFVVEDDKSFYYLASFKVTNIKYKENYGMRSSREFIERSHQIERMMSRIFRHSSVDGRFIKSHVIKLSPDEQGVDILTVLMFRYPSTDSAEQIKKKIEKALYQSLKTKQLSLTINKSSFRLTPIDSRKMRNLLNSRCGIRMTSSNMPLPASSSTQRIVQGRETAMEGEWPWQASLQLIGSGHQCGASLISNTWLLTAAHCFRRNKDPTQWIATFGTTITPPAVKRNLRKIILHENYHRETNENDIALAQLTTGVEFSNTIQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNKLRQARVETISTDVCNRKDVYDGLITPGMLCAGFMEGKIDACKGDSGGPLVYDNHDIWYIVGIVSWGQSCALPKKPGVYTRVTKYRDWIASKTGM.
For Research Use Only | Not For Clinical Use.
Online Inquiry