Mouse Anti-tmsb4x Antibody (CBMOAB-10103FYB)
Cat: CBMOAB-10103FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-10103FYB | Monoclonal | Zebrafish (Danio rerio), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO10103FYB | 100 µg | ||
| CBMOAB-60686FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60686FYA | 100 µg | ||
| MO-AB-08576H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08576C | 100 µg | ||
| MO-AB-29647H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29647C | 100 µg | ||
| MO-AB-30784R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30784R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO10103FYB |
| Specificity | This antibody binds to Zebrafish tmsb4x. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytoskeleton; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish tmsb4x Antibody is a mouse antibody against tmsb4x. It can be used for tmsb4x detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Beta thymosin-like protein; Zgc:195154; tmsb4 |
| UniProt ID | Q45QT2 |
| Protein Refseq | The length of the protein is 44 amino acids long. The sequence is show below: MSDKPNLEEVTSFDKTKLKKTETQEKNPLPSKETIEQEKQAGSS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry