Mouse Anti-Tomato ADH Antibody (MO-AB-34113H)


Cat: MO-AB-34113H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityTomato (Lycopersicon esculentum)
CloneMO34113C
SpecificityThis antibody binds to Tomato ADH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAlcohol dehydrogenase mostly active on ethanol (EtOH), but exhibits broad substrates selectivity for primary and secondary alcohols (e.g. butanol, propyl alcohol, pentanol, isopentanol, ethylene glycol, isopropanol, methanol and tertiary butyl alcohol) (PubMed:23707506). Converts allyl alcohol to highly toxic acryl-aldehyde (PubMed:20508152). Required for survival and acclimation in hypoxic conditions, especially in roots (PubMed:12857811, PubMed:9880346).
Product OverviewThis product is a mouse antibody against ADH. It can be used for ADH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative alcohol dehydrogenase; ADH
UniProt IDA6N6K9
Protein RefseqThe length of the protein is 328 amino acids long.
The sequence is show below: MESKNIGEGKVVCVTGASGYIASWLVKLLLQRGYTVNATVRNLKDTSKVDHLLGLDGANERLHLFEAELLEEQSFDPAVDGCEGVFHTASPVFLTGKSKEELVDPAVKGTLNVLRSCAKSPSVRRVVITSSTASVICNKNMSTPGAVADETWYSDPEFCEERKEWYQLSKTLAEQAAWKFAKENGVDLVTLHPGLVIGPLLQPTLNFSCEAIVDVIKEGKEAWSGGIYRFVDVRDVANAHILAFEVLSANGRYCLVGANGYSSLVLKIVQKLYPSITLPKNFKDGLPLTPHFQVSSEKAKRLGVKFTCLELSVKDTIESLKEKNFLHI.
See other products for " ADH "
CBMOAB-1658FYCMouse Anti-Arabidopsis ADH Antibody (CBMOAB-1658FYC)
MOFY-1222-FY185Rabbit Anti-Adh Antibody (MOFY-1222-FY185)
MO-AB-68771WMouse Anti-Silkworm ADH Antibody (MO-AB-68771W)
MO-DKB-0024RARabbit Anti-ADH Antibody (MO-DKB-0024RA)
CBMOAB-00727FYAMouse Anti-D. melanogaster Adh Antibody (CBMOAB-00727FYA)
MO-AB-00035HMouse Anti-Arabidopsis adh Antibody (MO-AB-00035H)
For Research Use Only | Not For Clinical Use.
Online Inquiry