Mouse Anti-Tomato Aqp2 Antibody (MO-AB-34172H)


Cat: MO-AB-34172H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityTomato (Lycopersicon esculentum)
CloneMO34172C
SpecificityThis antibody binds to Tomato Aqp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a water channel protein located in the kidney collecting tubule. It belongs to the MIP/aquaporin family, some members of which are clustered together on chromosome 12q13. Mutations in this gene have been linked to autosomal dominant and recessive forms of nephrogenic diabetes insipidus.
Product OverviewThis product is a mouse antibody against Aqp2. It can be used for Aqp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative water channel protein; Aqp2
UniProt IDQ9M624
Protein RefseqThe length of the protein is 285 amino acids long.
The sequence is show below: MEGKEEDVKVGANKYSERQPLGTSAQSKDYKEAPPAPLFEAGELHSWSFWRAGIAEFMATFLFLYITVLTVMGYSRANSKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSLFGTKGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIVYNKEHAWDDHWIFWVGPFIGAALAALYHQVIIRAIPFKSGN.
See other products for " AQP2 "
MO-AB-07236YMouse Anti-Rabbit AQP2 Antibody (MO-AB-07236Y)
MO-AB-00159YMouse Anti-Chicken AQP2 Antibody (MO-AB-00159Y)
MO-AB-41260WMouse Anti-Guinea pig aqp2 Antibody (MO-AB-41260W)
MO-AB-23837RMouse Anti-Pig aqp2 Antibody (MO-AB-23837R)
CBMOAB-00590HCBMouse Anti-C. elegans AQP2 Antibody (CBMOAB-00590HCB)
MO-AB-07525RMouse Anti-Cattle AQP2 Antibody (MO-AB-07525R)
MO-AB-01510HMouse Anti-Frog aqp2 Antibody (MO-AB-01510H)
MO-AB-14224YMouse Anti-Sheep AQP2 Antibody (MO-AB-14224Y)
MO-AB-29012WMouse Anti-Dog AQP2 Antibody (MO-AB-29012W)
MO-AB-43698WMouse Anti-Horse AQP2 Antibody (MO-AB-43698W)
For Research Use Only | Not For Clinical Use.
Online Inquiry