Mouse Anti-Tomato atpF Antibody (MO-AB-34205H)
Cat: MO-AB-34205H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Tomato (Lycopersicon esculentum) |
| Clone | MO34205C |
| Specificity | This antibody binds to Tomato atpF. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | FF ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F containing the extramembraneous catalytic core and F containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation. |
| Product Overview | This product is a mouse antibody against atpF. It can be used for atpF detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | AtpF protein; atpF |
| UniProt ID | G8D9M9 |
| Protein Refseq | The length of the protein is 44 amino acids long. The sequence is show below: MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFF. |
See other products for " atpF "
| MO-AB-30219H | Mouse Anti-Sugar beet atpF Antibody (MO-AB-30219H) |
| CBMOAB-18723FYB | Mouse Anti-Rice atpF Antibody (CBMOAB-18723FYB) |
| CBMOAB-0217YC | Mouse Anti-E. coli atpF Antibody (CBMOAB-0217YC) |
| MO-DKB-01952W | Rabbit Anti-AtpF Antibody (MO-DKB-01952W) |
| MO-AB-00044W | Mouse Anti-Barrel medic atpF Antibody (MO-AB-00044W) |
| MOFAB-290W | Rabbit Anti-ATPF Antibody (MOFAB-290W) |
| CBMOAB-24880FYC | Mouse Anti-Arabidopsis ATPF Antibody (CBMOAB-24880FYC) |
| MO-DKB-0075RA | Rabbit Anti-AtpF Antibody (MO-DKB-0075RA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry