Mouse Anti-Tomato atpF Antibody (MO-AB-34205H)
Cat: MO-AB-34205H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Tomato (Lycopersicon esculentum) |
Clone | MO34205C |
Specificity | This antibody binds to Tomato atpF. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Chloroplast; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | FF ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F containing the extramembraneous catalytic core and F containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation. |
Product Overview | This product is a mouse antibody against atpF. It can be used for atpF detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | AtpF protein; atpF |
UniProt ID | G8D9M9 |
Protein Refseq | The length of the protein is 44 amino acids long. The sequence is show below: MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFF. |
See other products for " atpF "
MO-AB-30219H | Mouse Anti-Sugar beet atpF Antibody (MO-AB-30219H) |
CBMOAB-18723FYB | Mouse Anti-Rice atpF Antibody (CBMOAB-18723FYB) |
CBMOAB-0217YC | Mouse Anti-E. coli atpF Antibody (CBMOAB-0217YC) |
MO-DKB-01952W | Rabbit Anti-AtpF Antibody (MO-DKB-01952W) |
MO-AB-00044W | Mouse Anti-Barrel medic atpF Antibody (MO-AB-00044W) |
MOFAB-290W | Rabbit Anti-ATPF Antibody (MOFAB-290W) |
CBMOAB-24880FYC | Mouse Anti-Arabidopsis ATPF Antibody (CBMOAB-24880FYC) |
MO-DKB-0075RA | Rabbit Anti-AtpF Antibody (MO-DKB-0075RA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry