Mouse Anti-Tomato MYB Antibody (MO-AB-34934H)
Cat: MO-AB-34934H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Tomato (Lycopersicon esculentum) |
Clone | MO34934C |
Specificity | This antibody binds to Tomato MYB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein with three HTH DNA-binding domains that functions as a transcription regulator. This protein plays an essential role in the regulation of hematopoiesis. This gene may be aberrently expressed or rearranged or undergo translocation in leukemias and lymphomas, and is considered to be an oncogene. Alternative splicing results in multiple transcript variants. |
Product Overview | This product is a mouse antibody against MYB. It can be used for MYB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | MYB transcription factor; MYB |
UniProt ID | Q8H1Z4 |
Protein Refseq | The length of the protein is 71 amino acids long. The sequence is show below: AGLLRCGKSCRLRWTNYLRPDIKRGNFTKEEEDTIIKLHENLGNRWSAIAARLPGRTDNEIKNIWHTHLKK. |
See other products for " MYB "
MO-AB-16267R | Mouse Anti-Cattle MYB Antibody (MO-AB-16267R) |
CBMOAB-25199FYA | Mouse Anti-D. melanogaster Myb Antibody (CBMOAB-25199FYA) |
MO-AB-45608W | Mouse Anti-Horse MYB Antibody (MO-AB-45608W) |
MO-AB-09852W | Mouse Anti-Chimpanzee MYB Antibody (MO-AB-09852W) |
CBMOAB-36833FYC | Mouse Anti-Arabidopsis MYB Antibody (CBMOAB-36833FYC) |
MO-AB-59584W | Mouse Anti-Marmoset MYB Antibody (MO-AB-59584W) |
CBMOAB-87901FYA | Mouse Anti-Zebrafish myb Antibody (CBMOAB-87901FYA) |
MO-AB-03021Y | Mouse Anti-Chicken MYB Antibody (MO-AB-03021Y) |
MO-AB-39257W | Mouse Anti-Grape MYB Antibody (MO-AB-39257W) |
CBMOAB-51992FYA | Mouse Anti-Rhesus MYB Antibody (CBMOAB-51992FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry