AibGenesis™ Mouse Anti-tomm5 Antibody (CBMOAB-10356FYB)


Cat: CBMOAB-10356FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10356FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO10356FYB 100 µg
MO-AB-06656W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06656W 100 µg
MO-AB-19409W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19409W 100 µg
MO-AB-22035R Monoclonal Cattle (Bos taurus) WB, ELISA MO22035R 100 µg
MO-AB-29689H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29689C 100 µg
MO-AB-66686W Monoclonal Marmoset WB, ELISA MO66686W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO10356FYB
SpecificityThis antibody binds to Zebrafish tomm5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tomm5 Antibody is a mouse antibody against tomm5. It can be used for tomm5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNovel protein; tomm5; OTTDARP00000001946 si:ch211-240l14.
UniProt IDQ7SZY9
Protein RefseqThe length of the protein is 74 amino acids long.
The sequence is show below: MDPEEMKKKMREDVITSVRNFLIYVALLRVKAGQHMKLHPWAKTFPVQKSMRDWDDAAQNRLHRQSTKRCGQFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry