AibGenesis™ Mouse Anti-tp53inp2 Antibody (CBMOAB-10424FYB)


Cat: CBMOAB-10424FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10424FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO10424FYB 100 µg
MO-AB-17237W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17237W 100 µg
MO-AB-29698H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29698C 100 µg
MO-AB-66727W Monoclonal Marmoset WB, ELISA MO66727W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO10424FYB
SpecificityThis antibody binds to Zebrafish tp53inp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene promotes autophagy and is essential for proper autophagosome formation and processing. In addition, the encoded protein can enhance rDNA transcription by helping in the assembly of the POLR1/RNA polymerase I preinitiation complex. Finally, this protein serves as a transcriptional activator for some genes. (From NCBI)
Product OverviewMouse Anti-Zebrafish tp53inp2 Antibody is a mouse antibody against tp53inp2. It can be used for tp53inp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestp53inp2; TP53INP2 Gene(Protein Coding) Tumor Protein P53 Inducible Nuclear Protein 2
UniProt IDE7F458
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: MFQRLTNLLFGSVNETTQEPTVPKPASPEVDEEGWLLVNAADGESSETGELQFKLIGSLSNTEICAASLVSEASIAEPEVPVARSSGRVSQRLVSQAGALVKVTQMGRIQRAQARANRHSLGRNCIQRQNNIRQRLPQHFSRKHRMVLHQPGRCNFNH.
For Research Use Only | Not For Clinical Use.
Online Inquiry