Mouse Anti-tp73 Antibody (CBMOAB-10441FYB)


Cat: CBMOAB-10441FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10441FYB Monoclonal Zebrafish (Danio rerio), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Rhesus (Macaca mulatta) WB, ELISA MO10441FYB 100 µg
Inquiry
CBMOAB-60895FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60895FYA 100 µg
Inquiry
MO-AB-01783R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01783R 100 µg
Inquiry
MO-AB-04547Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04547Y 100 µg
Inquiry
MO-AB-06664W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06664W 100 µg
Inquiry
MO-AB-06954Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06954Y 100 µg
Inquiry
MO-AB-26302W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26302W 100 µg
Inquiry
MO-AB-66734W Monoclonal Marmoset WB, ELISA MO66734W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Rhesus (Macaca mulatta)
CloneMO10441FYB
SpecificityThis antibody binds to Zebrafish tp73.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined.
Product OverviewMouse Anti-Zebrafish tp73 Antibody is a mouse antibody against tp73. It can be used for tp73 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesp73; tp7
UniProt IDQ801Z7
Protein RefseqThe length of the protein is 640 amino acids long.
The sequence is show below: MSQSSTADEGPTFEHLWSTLEPDSTYFELPQAGHSGDRASSSLPGNRAEVCMDVYHMRDMRDMNDNVMSQYSLLSSSMDQGLGNRAASTSPYSSETTSNVPTPSPYSQPNSTFEAMSPAPAIPSNTDYPGPHNFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKLASSPPNGSVIRAMPIYKKAEHVTEVVKRCPNHKLGRDFNESQTAPASHLIRVEGNNLCQYVDDPVTGRQSVLVPYESPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHFREQQALNESVAKNGNANKRNFKQTPTNITGPSINIKKRRHGEEEMYYIPVRGRENFDILMKIKDSLELVEFVPQQLVDSYRQQQQQLLQRQNHVASPSSYGTLNNMNKIHGPISKLPSVNQLVTQQTQQSAGPSASLSHMGANMLGGHHMQSNGDVNGAHQSQSIVSTSHCTPPPPYNPDPSLVSFLTSLGCQNCIDYFTSQGLQSVYHLQTLTMEDLGALKIPEQFRLAIWRGLQEMKQGHDYGQQLIRSSSNMATMAIGPSGELQRQRVMEAVHFRVRHTITIPNRGPANGPEEWPDFGFDMPDCRLHKHSIKEEFAEGDVH.
For Research Use Only | Not For Clinical Use.
Online Inquiry