Mouse Anti-tpgs2 Antibody (CBMOAB-08073FYB)
Cat: CBMOAB-08073FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-08073FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Rhesus (Macaca mulatta), Marmoset | WB, ELISA | MO08073FYB | 100 µg | ||
| MO-AB-08651H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08651C | 100 µg | ||
| MO-AB-15800W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15800W | 100 µg | ||
| MO-AB-22071R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22071R | 100 µg | ||
| MO-AB-66748W | Monoclonal | Marmoset | WB, ELISA | MO66748W | 100 µg | ||
| MO-DKB-01404W | Polyclonal | Human (Homo sapiens), Rhesus (Macaca mulatta) | WB, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Rhesus (Macaca mulatta), Marmoset |
| Clone | MO08073FYB |
| Specificity | This antibody binds to Zebrafish tpgs2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that is a component of the neuronal polyglutamylase complex, which plays a role in post-translational addition of glutamate residues to C-terminal tubulin tails. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish tpgs2 Antibody is a mouse antibody against tpgs2. It can be used for tpgs2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | tpgs2; TPGS2 Gene(Protein Coding) Tubulin Polyglutamylase Complex Subunit 2 |
| UniProt ID | F1QYJ6 |
| Protein Refseq | The length of the protein is 296 amino acids long. The sequence is show below: MEEVKDDKTYKGFVDRLTLGITRVLENLPGVLDVRFVEKAPAEKRCLLSWEQVWRKTTALCRKISEIFISQQMASCLPGTPSWKMKWFQWVA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry