Mouse Anti-TPPP Antibody (MO-AB-22083R)


Cat: MO-AB-22083R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22083R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO22083R 100 µg
MO-AB-29729H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29729C 100 µg
MO-AB-30862R Monoclonal Pig (Sus scrofa) WB, ELISA MO30862R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO22083R
SpecificityThis antibody binds to Cattle TPPP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTPPP (Tubulin Polymerization Promoting Protein) is a regulator of microtubule dynamics that plays a key role in myelination by promoting elongation of the myelin sheath. It acts as a microtubule nucleation factor in oligodendrocytes: specifically localizing to the postsynaptic Golgi apparatus region, also named Golgi outpost, and promoting microtubule nucleation, an important step for elongation of the myelin sheath. (From uniprot, under CC BY 4.0)
Product OverviewThis product is a mouse antibody against TPPP. It can be used for TPPP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTubulin polymerization-promoting protein; TPPP; 25 kDa brain-specific protein; p25-alpha; TPPP
UniProt IDQ27957
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MADSRPKPANKTPPKSPGEPAKDKAAKRLSLEAEGAGEGAAAAGAELSALEEAFRKFAVHGDARASGREMHGKNWSKLCRDCQVIDGRSVTVTDVDIVFSKIKGKSCRTITFEQFKEALEELAKKRFKDKSAEEAVREVHKLIEGKAPIISGVTKAISSPTVSRLTDTSKFTGSHKERFDPSGRGKGRAGRVDLVDESGYVPGYKHAGTYDQKVQGGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry