AibGenesis™ Mouse Anti-tprg1l Antibody (CBMOAB-10536FYB)


Cat: CBMOAB-10536FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10536FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO10536FYB 100 µg
CBMOAB-60947FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60947FYA 100 µg
MO-AB-08667H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08667C 100 µg
MO-AB-20124W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20124W 100 µg
MO-AB-22086R Monoclonal Cattle (Bos taurus) WB, ELISA MO22086R 100 µg
MO-AB-66782W Monoclonal Marmoset WB, ELISA MO66782W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO10536FYB
SpecificityThis antibody binds to Zebrafish tprg1l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tprg1l Antibody is a mouse antibody against tprg1l. It can be used for tprg1l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestprg1l; TPRG1L Gene(Protein Coding) Tumor Protein P63 Regulated 1 Like
UniProt IDB8A4V5
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: MLQLNDSVITLDPESPGAAVLLSADCDDGLEVSARAGASVACCSSLQTLTPFHVHNPTMRAKVKDYFVFRPGTIEQAVNDIRTVALPSEDGEVLSVWLLAEVDHWNNEKERLVLITERSLLVCKYDFINLQCQQVIRISLNAVDTISIGEFEFPPKSLNKREGTGIRVQWDKRPRASFMNRWNPWSTDIPYATFTEHPMAHADEKVASLCQLENFKTQLIQAVKKAHKEYPIPGRANGVLILERPLLIETYLGIMSFINNEAKLGYAMTRGKIGF.
For Research Use Only | Not For Clinical Use.
Online Inquiry