AibGenesis™ Mouse Anti-TRAPPC3L Antibody (CBMOAB-61033FYA)


Cat: CBMOAB-61033FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61033FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO61033FYA 100 µg
MO-AB-29745H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29745C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO61033FYA
SpecificityThis antibody binds to Rhesus TRAPPC3L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus; Endoplasmic reticulum; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTRAPPC3L (Trafficking Protein Particle Complex 3 Like) may play a role in vesicular transport from endoplasmic reticulum to Golgi. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus TRAPPC3L Antibody is a mouse antibody against TRAPPC3L. It can be used for TRAPPC3L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTRAPPC3L
UniProt IDF6SXJ2
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: MSRPAHRRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFLARSCVGRCHSYSEITDIIAQVAFKMYLGITPSVTCNNSSRNEFSLILDKNPLVEFVEELPAGRSSLCYCNLLCGIIRGALEMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDEKKYRRKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry