Mouse Anti-TRH-DE Antibody (MO-AB-30948R)


Cat: MO-AB-30948R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-30948R Monoclonal Pig (Sus scrofa), Dog (Canis lupus familiaris) WB, ELISA MO30948R 100 µg
MO-AB-33834W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33834W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Dog (Canis lupus familiaris)
CloneMO30948R
SpecificityThis antibody binds to Pig TRH-DE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against TRH-DE. It can be used for TRH-DE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThyrotropin-releasing hormone degrading enzyme, Fragment; TRH-DE
UniProt IDH7CHW1
Protein RefseqThe length of the protein is 54 amino acids long.
The sequence is show below: SDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAISEKKILLEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry