AibGenesis™ Mouse Anti-TRIM15 Antibody (MO-AB-13117W)


Cat: MO-AB-13117W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13117W Monoclonal Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO13117W 100 µg
MO-AB-29762H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29762C 100 µg
MO-AB-30960R Monoclonal Pig (Sus scrofa) WB, ELISA MO30960R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO13117W
SpecificityThis antibody binds to Chimpanzee TRIM15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. (From NCBI)
Product OverviewMouse Anti-Chimpanzee TRIM15 Antibody is a mouse antibody against TRIM15. It can be used for TRIM15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTripartite motif-containing protein 15; TRIM15
UniProt IDH2RAW1
Protein RefseqThe length of the protein is 396 amino acids long.
The sequence is show below: MAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDRLRSRLEALSMERDEIEDVKCREDQKLQVLLTQIESKKHQVETAFERLQQELEQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQVIREGLHGCEMKTFVSPEAISPDLVKKIRDFHRKILTLPEMMRMFSENLAHHLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQKKNLPDSPLRFDGLPAVLGFPGFSSGRHRWQVDVQLGDGGGCTVGVAGEGVRRKGEMGLSAEDGVWAVIISHQQCWASTSPGTDLPLSEIPRGVRVALDYEAGQVTLHNAQTQEPIFTFTASFSGKVFPFFAVWKKGSYLTLKG.
For Research Use Only | Not For Clinical Use.
Online Inquiry