AibGenesis™ Mouse Anti-tspan7 Antibody (CBMOAB-11058FYB)
Cat: CBMOAB-11058FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-11058FYB | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO11058FYB | 100 µg | ||
| MO-AB-01823R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01823R | 100 µg | ||
| MO-AB-04630Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04630Y | 100 µg | ||
| MO-AB-08092W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08092W | 100 µg | ||
| MO-AB-08788H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08788C | 100 µg | ||
| MO-AB-10346Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10346Y | 100 µg | ||
| MO-AB-13796W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13796W | 100 µg | ||
| MO-AB-18084Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18084Y | 100 µg | ||
| MO-AB-22302R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22302R | 100 µg | ||
| MO-AB-29812H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29812C | 100 µg | ||
| MO-AB-31020R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31020R | 100 µg | ||
| MO-AB-33870W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33870W | 100 µg | ||
| MO-AB-33948H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33948C | 100 µg | ||
| MO-AB-42770W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42770W | 100 µg | ||
| MO-AB-46935W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46935W | 100 µg | ||
| MO-AB-67033W | Monoclonal | Marmoset | WB, ELISA | MO67033W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO11058FYB |
| Specificity | This antibody binds to Zebrafish tspan7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked cognitive disability and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish tspan7 Antibody is a mouse antibody against tspan7. It can be used for tspan7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tetraspanin; tspan |
| UniProt ID | Q7SXT2 |
| Protein Refseq | The length of the protein is 251 amino acids long. The sequence is show below: MSPPSARLQTKPVITCLKTFLISYSLIFWFTGVILLAVGVWGKVNLEFDLLVNSEHGTNAPYVLIGTGAVIIIFGLFGCFATCRGSPWMLKLYAMFLVLVFLAELVAGISGFIFRHEIKAVLKGAYQKAESNYMGKDDEDLDRIQRTLQCCGEENYTSWANTTYFEKEGIPKSCCNVTASVNCTSAELKDLKKADSVVYHQGCFSLMSTTMEANLGIIAGISFGIAFFQVIGIFLACCLSRYITNNQYEMV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry