AibGenesis™ Mouse Anti-TSPO2 Antibody (CBMOAB-61389FYA)


Cat: CBMOAB-61389FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61389FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO61389FYA 100 µg
MO-AB-06739W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06739W 100 µg
MO-AB-29817H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29817C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO61389FYA
SpecificityThis antibody binds to Rhesus TSPO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TSPO2 Antibody is a mouse antibody against TSPO2. It can be used for TSPO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTSPO2
UniProt IDF7H6K6
Protein RefseqThe length of the protein is 170 amino acids long.
The sequence is show below: MQLQGAIFVLLPHLGPILVWLFTRDHMAGWCEGPRMLSWCPLHKVVLLVQTAIYSVVGYASYLVWKDLGGGLGWPLALPLGLYAVQLTISWAVLVLFFTVHNPGLALLHLLLLYGLVVSTALIWHPINKLAALLLLPYLAWLTMTSALTYHLWRDSLCPVHQPQPTEKSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry