AibGenesis™ Mouse Anti-TSSK1B Antibody (MO-AB-22322R)


Cat: MO-AB-22322R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22322R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO22322R 100 µg
MO-AB-31024R Monoclonal Pig (Sus scrofa) WB, ELISA MO31024R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa)
CloneMO22322R
SpecificityThis antibody binds to Cattle TSSK1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against TSSK1B. It can be used for TSSK1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTestis-specific serine/threonine-protein kinase 1; TSSK1B
UniProt IDG3N2D2
Protein RefseqThe length of the protein is 367 amino acids long.
The sequence is show below: MDDAAVLKRRGYIMGINLGEGSYAKVKSAYSERLKFNVAVKIIDRKKAPTDFLEKFLPREIEILAMLNHRSIIKTYEIFETSDGKVYIVMELGVQGDLLEFIKTRGALQEDDARKKFHQLSSAIKYCHDLDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDDSGRLTLSKTFCGSAAYAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIYRMLQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry