AibGenesis™ Mouse Anti-TUBB3 Antibody (CBMOAB-45382FYC)
Cat: CBMOAB-45382FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45382FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chicken (Gallus gallus), Fish, Human (Homo sapiens), Mouse (Mus musculus), Quail, Frog (Xenopus), Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Monkey (Macaca mulatta), Dog (Canis lupus familiaris), Hamster (Cricetulus griseus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Insect, Yeast, Rhesus (Macaca mulatta), Rice (Oryza), Soybean (Glycine max) | WB, ELISA | MO45382FC | 100 µg | ||
| CBMOAB-89730FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89730FYB | 100 µg | ||
| MO-AB-06764W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06764W | 100 µg | ||
| MO-AB-08814H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08814C | 100 µg | ||
| MO-AB-22388R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22388R | 100 µg | ||
| MO-AB-22525W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22525W | 100 µg | ||
| MO-AB-32678H | Monoclonal | Soybean (Glycine max) | WB, ELISA | MO32678C | 100 µg | ||
| MO-NAB-00304W | Monoclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Monkey (Macaca mulatta), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Hamster (Cricetulus griseus), Rabbit (Oryctolagus cuniculus) | ELISA, WB, IHC, IF, IP | NW0232 | 100 µg | ||
| MO-NAB-00308W | Monoclonal | Zebrafish (Danio rerio) | ELISA, WB | NW0236 | 100 µg | ||
| MO-NAB-00328W | Monoclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Monkey (Macaca mulatta), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Insect, Yeast | ELISA, WB, IHC | NW0256 | 100 µg | ||
| MO-NAB-00523W | Monoclonal | C. elegans (Caenorhabditis elegans), Chicken (Gallus gallus), Fish, Human (Homo sapiens), Mouse (Mus musculus), Quail, Frog (Xenopus), Zebrafish (Danio rerio) | IF, WB | NW0445 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chicken (Gallus gallus), Fish, Human (Homo sapiens), Mouse (Mus musculus), Quail, Frog (Xenopus), Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Monkey (Macaca mulatta), Dog (Canis lupus familiaris), Hamster (Cricetulus griseus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Insect, Yeast, Rhesus (Macaca mulatta), Rice (Oryza), Soybean (Glycine max) |
| Clone | MO45382FC |
| Specificity | This antibody binds to Arabidopsis TUBB3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytoskeleton; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis TUBB3 Antibody is a mouse antibody against TUBB3. It can be used for TUBB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tubulin Beta 3 Class III; Class III Beta-Tubulin; Tubulin Beta-4 Chain; Tubulin Beta-III; Tubulin, Beta 3; TUBB4; Fibrosis Of Extraocular Muscles, Congenital, 3; Tubulin Beta-3 Chain |
| UniProt ID | Q9ASR0 |
| Protein Refseq | The length of the protein is 450 amino acids long. The sequence is show below: MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTVPELTQQMWDSKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEEGDYEDEEEGEYQQEEEY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry