Mouse Anti-TULP3 Antibody (CBMOAB-45400FYC)


Cat: CBMOAB-45400FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45400FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries) WB, ELISA MO45400FC 100 µg
CBMOAB-61579FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61579FYA 100 µg
CBMOAB-89745FYB Monoclonal Rice (Oryza) WB, ELISA MO89745FYB 100 µg
MO-AB-06768W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06768W 100 µg
MO-AB-08270W Monoclonal Cat (Felis catus) WB, ELISA MO08270W 100 µg
MO-AB-15667W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15667W 100 µg
MO-AB-33902W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33902W 100 µg
MO-AB-35912W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35912W 100 µg
MO-AB-42780W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42780W 100 µg
MO-AB-46957W Monoclonal Horse (Equus caballus) WB, ELISA MO46957W 100 µg
MO-AB-67181W Monoclonal Marmoset WB, ELISA MO67181W 100 µg
MO-AB-22410R Monoclonal Cattle (Bos taurus) WB, ELISA MO22410R 100 µg
MO-AB-01835R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01835R 100 µg
MO-AB-08825H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08825C 100 µg
MO-AB-23846H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23846C 100 µg
MO-AB-29838H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29838C 100 µg
MO-AB-01580L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01580L 100 µg
MO-AB-04647Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04647Y 100 µg
MO-AB-10366Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10366Y 100 µg
MO-AB-18105Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18105Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries)
CloneMO45400FC
SpecificityThis antibody binds to Arabidopsis TULP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the tubby gene family of bipartite transcription factors. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved N-terminal transcription activation region and a conserved C-terminal DNA and phosphatidylinositol-phosphate binding region. The encoded protein binds to phosphoinositides in the plasma membrane via its C-terminal region and probably functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis, for instance, induced by G-protein-coupled-receptor signaling. It plays an important role in neuronal development and function. Two transcript variants encoding distinct isoforms have been identified for this gene. (From NCBI)
Product OverviewMouse Anti-Arabidopsis TULP3 Antibody is a mouse antibody against TULP3. It can be used for TULP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTubby Like Protein 3; TUBL3; Tubby-Related Protein 3; Tubby-Like Protein 3
UniProt IDQ8VY21
Protein RefseqThe length of the protein is 406 amino acids long. The sequence is show below: MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQDTSVPVDAFKQSCWASMPPELLRDVLMRIEQSEDTWPSRKNVVSCAGVCRNWREIVKEIVRVPELSSKLTFPISLKQPGPRGSLVQCYIMRNRSNQTYYLYLGLNQAASNDDGKFLLAAKRFRRPTCTDYIISLNCDDVSRGSNTYIGKLRSNFLGTKFTVYDAQPTNPGTQVTRTRSSRLLSLKQVSPRIPSGNYPVAHISYELNVLGSRGPRRMQCVMDAIPASAVEPGGTAPTQTELVHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLVLKNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAFTICLSSFDTKIACE.
For Research Use Only | Not For Clinical Use.
Online Inquiry