Mouse Anti-txndc17 Antibody (CBMOAB-11345FYB)


Cat: CBMOAB-11345FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11345FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO11345FYB 100 µg
MO-AB-08835H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08835C 100 µg
MO-AB-13467W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13467W 100 µg
MO-AB-18108Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18108Y 100 µg
MO-AB-29850H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29850C 100 µg
MO-AB-67202W Monoclonal Marmoset WB, ELISA MO67202W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO11345FYB
SpecificityThis antibody binds to Zebrafish txndc17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDisulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish txndc17 Antibody is a mouse antibody against txndc17. It can be used for txndc17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThioredoxin domain-containing protein 17; Thioredoxin-like protein 5; txndc17; txnl
UniProt IDQ6DBT3
Protein RefseqThe length of the protein is 123 amino acids long.
The sequence is show below: MSKYEEVAVHGYEEFCKAVSDRKGKEIFAYFSGDKDEHGKSWCPDCVKAEPVVRAELPHLPEGTVFIYCQVGDRPYWKDSNNDFKKTLKLTGVPTLLRYGTPQKLVEEECFKADLVRMMFTED.
For Research Use Only | Not For Clinical Use.
Online Inquiry