Mouse Anti-txndc9 Antibody (CBMOAB-11349FYB)


Cat: CBMOAB-11349FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11349FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO11349FYB 100 µg
MO-AB-08838H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08838C 100 µg
MO-AB-15555W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15555W 100 µg
MO-AB-22435R Monoclonal Cattle (Bos taurus) WB, ELISA MO22435R 100 µg
MO-AB-29853H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29853C 100 µg
MO-AB-67208W Monoclonal Marmoset WB, ELISA MO67208W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO11349FYB
SpecificityThis antibody binds to Zebrafish txndc9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation.
Product OverviewMouse Anti-Zebrafish txndc9 Antibody is a mouse antibody against txndc9. It can be used for txndc9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThioredoxin domain containing 9; Txndc9 protein; txndc
UniProt IDQ7ZVX9
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MASQSMDIVAKALEQQVLQSARMVEEQLDAELEKLERMDEDELELLKERRLEALKKAQKQKQEWISKGHGEYREIPSEKDFFPEVKESKSVVCHFYRDSTFRCKILDKHLAILAKKHLETKFIKLNVEKAPFLTERLRIKVIPTLALVKDGKTKDYIVGFSDLGNTDEFPTEMLEWRLGCSDIINYSGNLLEPPTVGQKTGSKFTKVEKKTIRGKAYDSDSESDED.
For Research Use Only | Not For Clinical Use.
Online Inquiry