Mouse Anti-ube2d2 Antibody (CBMOAB-11470FYB)
Cat: CBMOAB-11470FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-11470FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Frog (Xenopus), Marmoset, Rhesus (Macaca mulatta) | WB, ELISA | MO11470FYB | 100 µg | ||
| MO-AB-06796W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06796W | 100 µg | ||
| MO-AB-12593W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12593W | 100 µg | ||
| MO-AB-22494R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22494R | 100 µg | ||
| MO-AB-29875H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29875C | 100 µg | ||
| MO-AB-67274W | Monoclonal | Marmoset | WB, ELISA | MO67274W | 100 µg | ||
| MO-DKB-03222W | Polyclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Frog (Xenopus), Zebrafish (Danio rerio) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rat (Rattus norvegicus), Pig (Sus scrofa), Frog (Xenopus), Marmoset, Rhesus (Macaca mulatta) |
| Clone | MO11470FYB |
| Specificity | This antibody binds to Zebrafish ube2d2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Zebrafish ube2d2 Antibody is a mouse antibody against ube2d2. It can be used for ube2d2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Zgc:55886; Zgc:55886 protein; ube2d2; ube2d2l zgc:5588 |
| UniProt ID | Q7ZUK1 |
| Protein Refseq | The length of the protein is 147 amino acids long. The sequence is show below: MALKRIHKELHDLGRDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry