AibGenesis™ Mouse Anti-ube2f Antibody (CBMOAB-11480FYB)


Cat: CBMOAB-11480FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11480FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO11480FYB 100 µg
MO-AB-20357W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20357W 100 µg
MO-AB-22499R Monoclonal Cattle (Bos taurus) WB, ELISA MO22499R 100 µg
MO-AB-29882H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29882C 100 µg
MO-AB-67281W Monoclonal Marmoset WB, ELISA MO67281W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO11480FYB
SpecificityThis antibody binds to Zebrafish ube2f.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ube2f Antibody is a mouse antibody against ube2f. It can be used for ube2f detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNEDD8-conjugating enzyme UBE2F; EC 6.3.2.-; NEDD8 carrier protein UBE2F; NEDD8 protein ligase UBE2F; NEDD8-conjugating enzyme 2; Ubiquitin-conjugating enzyme E2 F; ube2f; NP_998479.1;XP_005160353.
UniProt IDQ6NY82
Protein RefseqThe length of the protein is 185 amino acids long.
The sequence is show below: MLTLASKLKREEGVRAGRTPAGSNDAAHRVSIRDRLLIKEVAELEANLPSTCKVTFPDENKLCHFQLAISPDEGYYLGGKFQFEIEVPEAYNMVPPKVKCLTRIWHPNIAETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIDAAEHHLRDKEDFRNKVQDFIKNYAR.
For Research Use Only | Not For Clinical Use.
Online Inquiry