Mouse Anti-UBP1 Antibody (CBMOAB-61728FYA)
Cat: CBMOAB-61728FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-61728FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Yeast | WB, ELISA | MO61728FYA | 100 µg | ||
CBMOAB-04765CR | Monoclonal | Yeast | WB, ELISA | MO04765CR | 100 µg | ||
MO-AB-26282W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26282W | 100 µg | ||
MO-AB-67331W | Monoclonal | Marmoset | WB, ELISA | MO67331W | 100 µg | ||
MO-AB-08902H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08902C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Yeast |
Clone | MO61728FYA |
Specificity | This antibody binds to Rhesus UBP1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Functions as a transcriptional activator in a promoter context-dependent manner. Modulates the placental expression of CYP11A1. Involved in regulation of the alpha-globin gene in erythroid cells. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with TFCP2 (By similarity). Involved in regulation of the alpha-globin gene in erythroid cells. Binds strongly to sequences around the HIV-1 initiation site and weakly over the TATA-box. Represses HIV-1 transcription by inhibiting the binding of TFIID to the TATA-box. |
Product Overview | Mouse Anti-Rhesus UBP1 Antibody is a mouse antibody against UBP1. It can be used for UBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | UBP1; UBP1 |
UniProt ID | A2D6D3 |
Protein Refseq | The length of the protein is 35 amino acids long. The sequence is show below: SIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDL. |
See other products for " UBP1 "
CBMOAB-45478FYC | Mouse Anti-UBP1 Antibody (CBMOAB-45478FYC) |
CBMOAB-11570FYB | Mouse Anti-ubp1 Antibody (CBMOAB-11570FYB) |
MO-AB-14448W | Mouse Anti-UBP1 Antibody (MO-AB-14448W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry