Mouse Anti-UBP1 Antibody (CBMOAB-61728FYA)


Cat: CBMOAB-61728FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61728FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Yeast WB, ELISA MO61728FYA 100 µg
CBMOAB-04765CR Monoclonal Yeast WB, ELISA MO04765CR 100 µg
MO-AB-26282W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26282W 100 µg
MO-AB-67331W Monoclonal Marmoset WB, ELISA MO67331W 100 µg
MO-AB-08902H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08902C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Yeast
CloneMO61728FYA
SpecificityThis antibody binds to Rhesus UBP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFunctions as a transcriptional activator in a promoter context-dependent manner. Modulates the placental expression of CYP11A1. Involved in regulation of the alpha-globin gene in erythroid cells. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with TFCP2. Involved in regulation of the alpha-globin gene in erythroid cells. Binds strongly to sequences around the HIV-1 initiation site and weakly over the TATA-box. Represses HIV-1 transcription by inhibiting the binding of TFIID to the TATA-box. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus UBP1 Antibody is a mouse antibody against UBP1. It can be used for UBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUBP1; UBP1
UniProt IDA2D6D3
Protein RefseqThe length of the protein is 35 amino acids long.
The sequence is show below: SIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry