Mouse Anti-ubxn2a Antibody (CBMOAB-11628FYB)


Cat: CBMOAB-11628FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11628FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO11628FYB 100 µg
CBMOAB-61761FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61761FYA 100 µg
MO-AB-06807W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06807W 100 µg
MO-AB-08910H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08910C 100 µg
MO-AB-19044W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19044W 100 µg
MO-AB-67354W Monoclonal Marmoset WB, ELISA MO67354W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO11628FYB
SpecificityThis antibody binds to Zebrafish ubxn2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionUBXN2A (UBX Domain Protein 2A) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include ubiquitin binding and acetylcholine receptor binding. An important paralog of this gene is NSFL1C.
Product OverviewMouse Anti-Zebrafish ubxn2a Antibody is a mouse antibody against ubxn2a. It can be used for ubxn2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesubxn2a; FP103080.2 si:ch73-97d3.1; UBX Domain Protein 2A
UniProt IDE7EY86
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: MMKNIDSRERHEDDTWCEGAQNEEEEEEEDEEASPIRSSFSVEDLLDEVEKISSVASSGKKVEIVVRLWKNGFTLNDEDLRSYTQEENQEFLEAIKKGELPLELEGRAEDEELEVNVEDMKDEVYVPKKKIFHPFTGRGYRLGSVAPRVVARSRSIHEDCSGPPVPAVELNEDLPVTSLQIWLADGRRLVQRFNLCHRISDVQRFVEQAQITDTPFILTTSLPFRELTDEAQSLEEADLANAVIVQRPVNTHAPFGHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry