Mouse Anti-UGP2 Antibody (MO-AB-22572R)


Cat: MO-AB-22572R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22572R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Hybrid fish (crucian-carp) WB, ELISA MO22572R 100 µg
CBMOAB-61801FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61801FYA 100 µg
MO-AB-24441W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24441W 100 µg
MO-AB-43505W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43505W 100 µg
MO-AB-08928H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08928C 100 µg
MO-DKB-00357W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Hybrid fish (crucian-carp) WB, ICC 100 µg
MO-DKB-01347W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus) WB, IHC, IHC-P 100 µg
MO-DKB-01447W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Hybrid fish (crucian-carp)
CloneMO22572R
SpecificityThis antibody binds to Cattle UGP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Product OverviewThis product is a mouse antibody against UGP2. It can be used for UGP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUTP--glucose-1-phosphate uridylyltransferase; EC 2.7.7.9; UDP-glucose pyrophosphorylase; UDPGP; UGPase; UGP2
UniProt IDQ07130
Protein RefseqThe length of the protein is 508 amino acids long.
The sequence is show below: MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTAPSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNVSSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYDTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKNVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNL.
See other products for " UGP2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry