AibGenesis™ Mouse Anti-UGP2 Antibody (MO-AB-22572R)
Cat: MO-AB-22572R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-22572R | Monoclonal | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Hybrid fish (crucian-carp) | WB, ELISA | MO22572R | 100 µg | ||
| CBMOAB-61801FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO61801FYA | 100 µg | ||
| MO-AB-24441W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24441W | 100 µg | ||
| MO-AB-43505W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43505W | 100 µg | ||
| MO-AB-08928H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08928C | 100 µg | ||
| MO-DKB-00357W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Hybrid fish (crucian-carp) | WB, ICC | 100 µg | |||
| MO-DKB-01347W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus) | WB, IHC, IHC-P | 100 µg | |||
| MO-DKB-01447W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Hybrid fish (crucian-carp) |
| Clone | MO22572R |
| Specificity | This antibody binds to Cattle UGP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] (From NCBI) |
| Product Overview | This product is a mouse antibody against UGP2. It can be used for UGP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | UTP--glucose-1-phosphate uridylyltransferase; EC 2.7.7.9; UDP-glucose pyrophosphorylase; UDPGP; UGPase; UGP2 |
| UniProt ID | Q07130 |
| Protein Refseq | The length of the protein is 508 amino acids long. The sequence is show below: MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTAPSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNVSSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYDTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKNVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNL. |
See other products for " UGP2 "
| CBMOAB-45569FYC | AibGenesis™ Mouse Anti-UGP2 Antibody (CBMOAB-45569FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry