Mouse Anti-UPB1 Antibody (MO-AB-22612R)


Cat: MO-AB-22612R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22612R Monoclonal Cattle (Bos taurus), C. elegans (Caenorhabditis elegans), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO22612R 100 µg
CBMOAB-61880FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61880FYA 100 µg
CBMOAB-15395FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO15395FYB 100 µg
CBMOAB-13051HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO13051HB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), C. elegans (Caenorhabditis elegans), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO22612R
SpecificityThis antibody binds to Cattle UPB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity. (From NCBI)
Product OverviewThis product is a mouse antibody against UPB1. It can be used for UPB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUPB1 protein; UPB1
UniProt IDA7MBE8
Protein RefseqThe length of the protein is 384 amino acids long.
The sequence is show below: MAGSGFESLEQCLEKHLPLAELQEVKRLLYGKETRKLDLPGAALEAASRGDFELQGYAFEAAAEQQRRPRTVRVGLVQNRTPLPADTPVVKQVTALHRRMEAVVEVAAMCGVNIICFQEAWTMPFAFCTREKLPWTEFAESAEDGPTIKFCQELARKHGMVVVSPVLERDSDHGDVLWNTAVVVASSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFN.
See other products for " UPB1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry