AibGenesis™ Mouse Anti-VASH1 Antibody (MO-AB-21440W)


Cat: MO-AB-21440W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-21440W Monoclonal Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO21440W 100 µg
MO-AB-67621W Monoclonal Marmoset WB, ELISA MO67621W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset
CloneMO21440W
SpecificityThis antibody binds to Chimpanzee VASH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee VASH1 Antibody is a mouse antibody against VASH1. It can be used for VASH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVasohibin 1; VASH1
UniProt IDH2Q8N9
Protein RefseqThe length of the protein is 365 amino acids long.
The sequence is show below: MPGGKKVVGGGSSGATPTSAAATAPSGVRRLETSEGTSAERDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKPSEPKAMPDLNGYQIRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry