Mouse Anti-vat1 Antibody (CBMOAB-08154FYB)


Cat: CBMOAB-08154FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08154FYB Monoclonal Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rhesus (Macaca mulatta) WB, ELISA MO08154FYB 100 µg
CBMOAB-45811FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO45811FC 100 µg
CBMOAB-62053FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62053FYA 100 µg
MO-AB-09017H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09017C 100 µg
MO-AB-24638W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24638W 100 µg
MO-AB-26895W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26895W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rhesus (Macaca mulatta)
CloneMO08154FYB
SpecificityThis antibody binds to Zebrafish vat1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSynaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.
Product OverviewMouse Anti-Zebrafish vat1 Antibody is a mouse antibody against vat1. It can be used for vat1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVesicle amine transport protein 1 homolog; T californica; vat
UniProt IDF1Q7W5
Protein RefseqThe length of the protein is 538 amino acids long.
The sequence is show below: MSGEDAPAQQQNAEEQKQQETKTPAESPKTESKPDPPPTSASTEAAATAAAAADTPAPAAEKAPEEDTFTYRALVLTGYGGYDKVKLQVKKGKPALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPGMESSGVIEAVGEEVTDRKVGDKVLVLNRSGMWQEVVVVASTHTFLMPEGMSFEEAAALPVNYITAYMMLFDFGHLRPNQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTASASKHEVISQGGVTHPIDYRTRDYVEEVRKISPKGLDIVLDPLGGSDTHKGYNLLKPMGKLISYGAANMLAGQKKNLFAVAKTWYQQFSVHTLSLIQGNRSVCGFHLGYLDSETELIDQAMTAVMDLYRQGKVKPRIDSTYHLEQVGDAMRRMQERNNIGKIILTTEPMKEEEKKEEAKKDEEKKDDKKKDDKKKDDKKKEDKKKDEAKKEEKKDEKKKEEAKKDDKKAEEKKEEVKKEEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry