Mouse Anti-VDAC1 Antibody (CBMOAB-45816FYC)
Cat: CBMOAB-45816FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
- Relate Reference Data
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45816FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Arabidopsis, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Zebrafish (Danio rerio), Marmoset, Rabbit (Oryctolagus cuniculus), Rice (Oryza), Sheep (Ovis aries) | WB, ELISA | MO45816FC | 100 µg | ||
| CBMOAB-15745FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO15745FYB | 100 µg | ||
| CBMOAB-13108HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO13108HB | 100 µg | ||
| CBMOAB-89805FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89805FYB | 100 µg | ||
| MO-AB-14346W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14346W | 100 µg | ||
| MO-AB-47057W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO47057W | 100 µg | ||
| MO-AB-67649W | Monoclonal | Marmoset | WB, ELISA | MO67649W | 100 µg | ||
| MO-AB-22762R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22762R | 100 µg | ||
| MO-AB-09024H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO09024C | 100 µg | ||
| MO-AB-10457Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10457Y | 100 µg | ||
| MO-AB-18206Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18206Y | 100 µg | ||
| MO-DKB-00085W | Polyclonal | A. thaliana (Arabidopsis thaliana) | ELISA | 100 µg | |||
| MO-DKB-00086W | Polyclonal | A. thaliana (Arabidopsis thaliana) | IA | 100 µg | |||
| MO-DKB-00088W | Polyclonal | A. thaliana (Arabidopsis thaliana) | ELISA, WB | 100 µg | |||
| MO-DKB-00354W | Polyclonal | Human (Homo sapiens), Zebrafish (Danio rerio) | WB, ICC, IHC-P | 100 µg | |||
| MO-DKB-01808W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
| MOFAB-191W | Polyclonal | Arabidopsis | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Arabidopsis, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Zebrafish (Danio rerio), Marmoset, Rabbit (Oryctolagus cuniculus), Rice (Oryza), Sheep (Ovis aries) |
| Clone | MO45816FC |
| Specificity | This antibody binds to Arabidopsis VDAC1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Vacuole; Cytosol; Chloroplast; Other locations; Plasma Membrane; Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y. |
| Product Overview | Mouse Anti-Arabidopsis VDAC1 Antibody is a mouse antibody against VDAC1. It can be used for VDAC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Voltage Dependent Anion Channel 1; Outer Mitochondrial Membrane Protein Porin 1; Plasmalemmal Porin; Porin 31HL; Porin 31HM; VDAC-1 |
| UniProt ID | Q9SRH5 |
| Protein Refseq | The length of the protein is 276 amino acids long. The sequence is show below: MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQSRRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKSIDKSAKVGLALALKP. |
Reference
| Reference | 1. Tateda, C., Watanabe, K., Kusano, T., & Takahashi, Y. (2011). Molecular and genetic characterization of the gene family encoding the voltage-dependent anion channel in Arabidopsis. Journal of experimental botany, 62(14), 4773-4785. 2. Kwon, T. (2016). Mitochondrial porin isoform AtVDAC1 regulates the competence of Arabidopsis thaliana to Agrobacterium-mediated genetic transformation. Molecules and Cells, 39(9), 705. |
Relate Reference Data
Figure 1 Characterization of ura1 mutants resistant to oncogenic Agrobacterium tumefaciens A208. Expression of AtVDAC1 in WT and ura1 mutant plants.
Reference: Kwon, T. (2016). Mitochondrial porin isoform AtVDAC1 regulates the competence of Arabidopsis thaliana to Agrobacterium-mediated genetic transformation. Molecules and Cells, 39(9), 705.
For Research Use Only | Not For Clinical Use.
Online Inquiry