AibGenesis™ Mouse Anti-VDAC1 Antibody (CBMOAB-45816FYC)


Cat: CBMOAB-45816FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45816FYC Monoclonal A. thaliana (Arabidopsis thaliana), Arabidopsis, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Zebrafish (Danio rerio), Marmoset, Rabbit (Oryctolagus cuniculus), Rice (Oryza), Sheep (Ovis aries) WB, ELISA MO45816FC 100 µg
CBMOAB-15745FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO15745FYB 100 µg
CBMOAB-13108HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO13108HB 100 µg
CBMOAB-89805FYB Monoclonal Rice (Oryza) WB, ELISA MO89805FYB 100 µg
MO-AB-14346W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14346W 100 µg
MO-AB-47057W Monoclonal Horse (Equus caballus) WB, ELISA MO47057W 100 µg
MO-AB-67649W Monoclonal Marmoset WB, ELISA MO67649W 100 µg
MO-AB-22762R Monoclonal Cattle (Bos taurus) WB, ELISA MO22762R 100 µg
MO-AB-09024H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09024C 100 µg
MO-AB-10457Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10457Y 100 µg
MO-AB-18206Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18206Y 100 µg
MO-DKB-00085W Polyclonal A. thaliana (Arabidopsis thaliana) ELISA 100 µg
MO-DKB-00086W Polyclonal A. thaliana (Arabidopsis thaliana) IA 100 µg
MO-DKB-00088W Polyclonal A. thaliana (Arabidopsis thaliana) ELISA, WB 100 µg
MO-DKB-00354W Polyclonal Human (Homo sapiens), Zebrafish (Danio rerio) WB, ICC, IHC-P 100 µg
MO-DKB-01808W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MOFAB-191W Polyclonal Arabidopsis WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Arabidopsis, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Zebrafish (Danio rerio), Marmoset, Rabbit (Oryctolagus cuniculus), Rice (Oryza), Sheep (Ovis aries)
CloneMO45816FC
SpecificityThis antibody binds to Arabidopsis VDAC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationVacuole; Cytosol; Chloroplast; Other locations; Plasma Membrane; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y. (From NCBI)
Product OverviewMouse Anti-Arabidopsis VDAC1 Antibody is a mouse antibody against VDAC1. It can be used for VDAC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVoltage Dependent Anion Channel 1; Outer Mitochondrial Membrane Protein Porin 1; Plasmalemmal Porin; Porin 31HL; Porin 31HM; VDAC-1
UniProt IDQ9SRH5
Protein RefseqThe length of the protein is 276 amino acids long. The sequence is show below: MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQSRRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKSIDKSAKVGLALALKP.

Reference

Reference1. Tateda, C., Watanabe, K., Kusano, T., & Takahashi, Y. (2011). Molecular and genetic characterization of the gene family encoding the voltage-dependent anion channel in Arabidopsis. Journal of experimental botany, 62(14), 4773-4785.
2. Kwon, T. (2016). Mitochondrial porin isoform AtVDAC1 regulates the competence of Arabidopsis thaliana to Agrobacterium-mediated genetic transformation. Molecules and Cells, 39(9), 705.
For Research Use Only | Not For Clinical Use.
Online Inquiry