AibGenesis™ Mouse Anti-VP Antibody (MO-AB-28185W)


Cat: MO-AB-28185W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-28185W Monoclonal Cottonwood (Populus deltoids), Cucumber (Cucumis sativus) WB, ELISA MO28185W 100 µg
MO-AB-28689W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28689W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCottonwood (Populus deltoids), Cucumber (Cucumis sativus)
CloneMO28185W
SpecificityThis antibody binds to Cottonwood VP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cottonwood VP Antibody is a mouse antibody against VP. It can be used for VP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMORC family ATPase; VP
UniProt IDL0BAP8
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: DTQPSAIPNGVPSSESYFXGVFENLPIISGYSGLLHSLKGSTDTHLSALSKHLHSASGDISWHKSEKQEARTRDGLLLPSLLAPERKRLRN.
For Research Use Only | Not For Clinical Use.
Online Inquiry