AibGenesis™ Mouse Anti-vrk3 Antibody (CBMOAB-15925FYB)


Cat: CBMOAB-15925FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15925FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rhesus (Macaca mulatta) WB, ELISA MO15925FYB 100 µg
MO-AB-06888W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06888W 100 µg
MO-AB-09083H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09083C 100 µg
MO-AB-18903W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18903W 100 µg
MO-AB-22829R Monoclonal Cattle (Bos taurus) WB, ELISA MO22829R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rhesus (Macaca mulatta)
CloneMO15925FYB
SpecificityThis antibody binds to Zebrafish vrk3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. In both human and mouse, this gene has substitutions at several residues within the ATP binding motifs that in other kinases have been shown to be required for catalysis. In vitro assays indicate the protein lacks phosphorylation activity. The protein, however, likely retains its substrate binding capability. This gene is widely expressed in human tissues and its protein localizes to the nucleus. Alternative splicing results in multiple transcripts encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Zebrafish vrk3 Antibody is a mouse antibody against vrk3. It can be used for vrk3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesvrk3; Vaccinia Related Kinase 3
UniProt IDF1RE77
Protein RefseqThe length of the protein is 512 amino acids long.
The sequence is show below: MLNFCPQCGSKLQAGFRFCPSCGEKLPENPTDEDEPSPQQESHINAVISSVSAMEVDCAGDSSPSALSRPPLRTTRRKTLSNTNTEYTEQKPVPSSRKRKSSQLVKEEEEVAKKTQSILSQTPDKTSFTPPRKGKASPQIKEQDEIKQTNLSTLQTPDKMSSMSLQKYKASPLIKDEEAKKTSPAIQSPSKCKSKKRVSSVDPVLEGTVVCDQSGKKWKLIELLWKTELDVTYGVCQANQHAESDECKYMLRLGAKEGHLFNEQNFHLRAAKPDAVEKWGKLHKLDFLGIPSCVGFGLHETYRFLVFPCMGQPLQTELDEGTGSLSEKNVLQLALRLLDSLEFIHEKEYAHADIHAGNIYIKSSSHTEVFLSGFGHAFRFCPGGKHVEYRQGSRTAHQGNISFISLDSHKGAGPSRRSDLQSLGYCMLCWMTGSLPWSHLSHNSSSVAAEKERYMSDVPGLLTYCYKQKKASSALQEYLCNVMALQYTEKPDYTLLKGGLQQSLQKMGGSLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry