Mouse Anti-vwc2l Antibody (CBMOAB-16023FYB)


Cat: CBMOAB-16023FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16023FYB Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO16023FYB 100 µg
CBMOAB-62203FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62203FYA 100 µg
MO-AB-06893W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06893W 100 µg
MO-AB-30006H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30006C 100 µg
MO-AB-67760W Monoclonal Marmoset WB, ELISA MO67760W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO16023FYB
SpecificityThis antibody binds to Zebrafish vwc2l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionVWC2L (Von Willebrand Factor C Domain Containing Protein 2 Like) is a Protein Coding gene. An important paralog of this gene is VWC2.
Product OverviewMouse Anti-Zebrafish vwc2l Antibody is a mouse antibody against vwc2l. It can be used for vwc2l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesvon Willebrand factor C domain-containing protein 2-like; vwc2
UniProt IDB0UZC8
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MGPFLPAICVVLLALNAAVSPASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS.
For Research Use Only | Not For Clinical Use.
Online Inquiry