Mouse Anti-wdfy1 Antibody (CBMOAB-16088FYB)


Cat: CBMOAB-16088FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16088FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO16088FYB 100 µg
CBMOAB-62243FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62243FYA 100 µg
MO-AB-10566W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10566W 100 µg
MO-AB-22905R Monoclonal Cattle (Bos taurus) WB, ELISA MO22905R 100 µg
MO-AB-30014H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30014C 100 µg
MO-AB-38406W Monoclonal Goat (Capra hircus) WB, ELISA MO38406W 100 µg
MO-AB-67792W Monoclonal Marmoset WB, ELISA MO67792W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO16088FYB
SpecificityThis antibody binds to Zebrafish wdfy1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a phosphatidylinositol 3-phosphate binding protein, which contains a FYVE zinc finger domain and multiple WD-40 repeat domains. When exogenously expressed, it localizes to early endosomes. Mutagenesis analysis demonstrates that this endosomal localization is mediated by the FYVE domain.
Product OverviewMouse Anti-Zebrafish wdfy1 Antibody is a mouse antibody against wdfy1. It can be used for wdfy1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWD repeat and FYVE domain containing 1; wdfy
UniProt IDQ5XJM8
Protein RefseqThe length of the protein is 410 amino acids long.
The sequence is show below: MAAEIHSRPQSSRPVLLNKIEGHSDGVNAAVLIPKEDGVITASEDRTIRVWLKRDSGQYWPSIYHTVSSPCSCVSYHHESRRIFIGQDNGAVVEFLISEDLNKMNHVKTYPAHQNRVSDLLFSLESQWLVSTGHDKSISWMSTQSGSMLGRHSFGSWASCLQYDNDTQHAFVGDYSGQITLLKLDEHSCSVITTLKGHEGSVGALYWDPVHRWLFSGASDHSVIMWDIGGRQGRTLLLQGHHEKVQALRYLPLTRQLVSCSADGGITVWNMDTTRQEAPQWLDSDSCQKCEQPFFWNIKQMWDTKTLGLRQHHCRKCGKAICGKCSSKRSTYPIMGFEFQVRMCDDCFNTIKEDDRTPLATFHEGKHSIAHMDMDPNRGLMVTCGSDRVVKIWDMTQVVGSSVAAGFSHR.
For Research Use Only | Not For Clinical Use.
Online Inquiry