Mouse Anti-Whip Antibody (CBMOAB-34380FYA)


Cat: CBMOAB-34380FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34380FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus) WB, ELISA MO34380FYA 100 µg
CBMOAB-45999FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO45999FC 100 µg
MO-AB-04776Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04776Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus)
CloneMO34380FYA
SpecificityThis antibody binds to fruit fly Whip.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Whip Antibody is a mouse antibody against Whip. It can be used for Whip detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWhipple; whip
UniProt IDA8DY71
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MCAERLTKLLVRYSRAQPPVGRNQSHCVDNVLSPLPRSEATTAFLKPMNNAGQDHPPSKSANKWQPMGTITSIGQRFQREAMDEICARAKDRLLPKTEPRRLNFSRNHAFFPNKSRGLEDWKKPEGGRYSAPFVSLFQAPNCPSLPKKSFSHPLAFDRQKLYRDCY.
For Research Use Only | Not For Clinical Use.
Online Inquiry