Mouse Anti-WNT9A Antibody (CBMOAB-62418FYA)
Cat: CBMOAB-62418FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-62418FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO62418FYA | 100 µg | ||
CBMOAB-16348FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO16348FYB | 100 µg | ||
MO-AB-07589W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07589W | 100 µg | ||
MO-AB-19712W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19712W | 100 µg | ||
MO-AB-34074W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO34074W | 100 µg | ||
MO-AB-35995W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35995W | 100 µg | ||
MO-AB-22991R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22991R | 100 µg | ||
MO-AB-01933R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01933R | 100 µg | ||
MO-AB-09144H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO09144C | 100 µg | ||
MO-AB-30050H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO30050C | 100 µg | ||
MO-AB-34041H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO34041C | 100 µg | ||
MO-AB-01694L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01694L | 100 µg | ||
MO-AB-04798Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04798Y | 100 µg | ||
MO-AB-10507Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10507Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
Clone | MO62418FYA |
Specificity | This antibody binds to Rhesus WNT9A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is expressed in gastric cancer cell lines. The protein encoded by this gene shows 75% amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region. (From NCBI) |
Product Overview | Mouse Anti-Rhesus WNT9A Antibody is a mouse antibody against WNT9A. It can be used for WNT9A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein Wnt; WNT9A |
UniProt ID | H9F4Q8 |
Protein Refseq | The length of the protein is 107 amino acids long. The sequence is show below: EAAGEAGAISPPRGRASGVGSSDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG. |
See other products for " WNT9A "
MO-AB-67924W | Mouse Anti-WNT9A Antibody (MO-AB-67924W) |
MO-AB-31265R | Mouse Anti-WNT9A Antibody (MO-AB-31265R) |
MO-AB-18270Y | Mouse Anti-WNT9A Antibody (MO-AB-18270Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry