AibGenesis™ Mouse Anti-WNT9A Antibody (CBMOAB-62418FYA)


Cat: CBMOAB-62418FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62418FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO62418FYA 100 µg
CBMOAB-16348FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO16348FYB 100 µg
MO-AB-07589W Monoclonal Cat (Felis catus) WB, ELISA MO07589W 100 µg
MO-AB-19712W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19712W 100 µg
MO-AB-34074W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO34074W 100 µg
MO-AB-35995W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35995W 100 µg
MO-AB-22991R Monoclonal Cattle (Bos taurus) WB, ELISA MO22991R 100 µg
MO-AB-01933R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01933R 100 µg
MO-AB-09144H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09144C 100 µg
MO-AB-30050H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30050C 100 µg
MO-AB-34041H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO34041C 100 µg
MO-AB-01694L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01694L 100 µg
MO-AB-04798Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04798Y 100 µg
MO-AB-10507Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10507Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO62418FYA
SpecificityThis antibody binds to Rhesus WNT9A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is expressed in gastric cancer cell lines. The protein encoded by this gene shows 75% amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region. (From NCBI)
Product OverviewMouse Anti-Rhesus WNT9A Antibody is a mouse antibody against WNT9A. It can be used for WNT9A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt; WNT9A
UniProt IDH9F4Q8
Protein RefseqThe length of the protein is 107 amino acids long.
The sequence is show below: EAAGEAGAISPPRGRASGVGSSDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG.
For Research Use Only | Not For Clinical Use.
Online Inquiry