AibGenesis™ Mouse Anti-wrnip1 Antibody (CBMOAB-16357FYB)
Cat: CBMOAB-16357FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-16357FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset | WB, ELISA | MO16357FYB | 100 µg | ||
| MO-AB-09147H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO09147C | 100 µg | ||
| MO-AB-17018W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17018W | 100 µg | ||
| MO-AB-22995R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22995R | 100 µg | ||
| MO-AB-67931W | Monoclonal | Marmoset | WB, ELISA | MO67931W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset |
| Clone | MO16357FYB |
| Specificity | This antibody binds to Zebrafish wrnip1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Werner's syndrome is a rare autosomal recessive disorder characterized by accelerated aging that is caused by defects in the Werner syndrome ATP-dependent helicase gene (WRN). The protein encoded by this gene interacts with the exonuclease-containing N-terminal portion of the Werner protein. This protein has a ubiquitin-binding zinc-finger domain in the N-terminus, an ATPase domain, and two leucine zipper motifs in the C-terminus. It has sequence similarity to replication factor C family proteins and is conserved from E. coli to human. This protein likely accumulates at sites of DNA damage by interacting with polyubiquinated proteins and also binds to DNA polymerase delta and increases the initiation frequency of DNA polymerase delta-mediated DNA synthesis. This protein also interacts with nucleoporins at nuclear pore complexes. Two transcript variants encoding different isoforms have been isolated for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish wrnip1 Antibody is a mouse antibody against wrnip1. It can be used for wrnip1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Zgc:85976; wrnip1; zgc:8597 |
| UniProt ID | Q6NW46 |
| Protein Refseq | The length of the protein is 546 amino acids long. The sequence is show below: MAESVSDSSVQCPVCAGLFEPSSINRHLDACLQSPSDPGPPAKKPRINSSDSRPSAVFSMFQSRPRASEALAEDSGESAAGSAAPAAAVQQPQCPAEVAPPAACSPRALRLKNQKPLAELLRPSTLEEYFGQNKLIGEQTLLRSLLKSQEIPSLILWGPPGCGKTTLAHIIASSIKQKGTGRFVTLSATSASVSDVREVIKQAQNELRLCKRKTVLFIDEIHRFNKSQQDTFLPHVECGTITLIGATTENPSFQVNSALLSRCRVLVLERLSVEAVGSILRRAVDFLDLRILDSEERHSSEICSEAQVCVEQKALDTLAHLCDGDARAALNGLQLAVQACVLQSSSNHNRSSTVVREQHIKEALQRSHILYDKAGEEHYNCISALHKSMRGSDANAALYWLARMLEGGEDPLYVARRLVRFASEDIGLADPVALSQAVAAFQACHLIGMPECEVILAQCAVYLARAPKSVEVYKAYNNVKMCLRNHKGPLPSVPLHLRNAPTKLMKNLGYAKGYKYNPNYSGPVKQEYLPEELRGVDFFTWTPSDS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry