Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Yeast EMC4 Antibody (CBMOAB-01183CR)


Cat: CBMOAB-01183CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO01183CR
SpecificityThis antibody binds to Yeast EMC4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEMC4 (ER Membrane Protein Complex Subunit 4) is a Protein Coding gene.
Product OverviewMouse Anti-Yeast EMC4 (clone MO01183CR) Antibody (CBMOAB-01183CR) is a mouse antibody against EMC4. It can be used for EMC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesER membrane protein complex subunit 4; EMC4; YGL231C
UniProt IDP53073
Protein RefseqThe length of the protein is 190 amino acids long. The sequence is show below: MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAHYNNGLQWFSD.
For Research Use Only | Not For Clinical Use.

Online Inquiry