Mouse Anti-Yeast MRPL39 Antibody (CBMOAB-02415CR)
Cat: CBMOAB-02415CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast |
Clone | MO02415CR |
Specificity | This antibody binds to Yeast MRPL39. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. |
Product Overview | Mouse Anti-Yeast MRPL39 Antibody is a mouse antibody against MRPL39. It can be used for MRPL39 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 54S ribosomal protein L39, mitochondrial; YmL39; MRPL39; YML009C |
UniProt ID | P36533 |
Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: MVKVKSKNSVIKLLSTAASGYSRYISIKKGAPLVTQVRYDPVVKRHVLFKEAKKRKVAERKPLDFLRTAK. |
See other products for " MRPL39 "
MO-AB-04483W | Mouse Anti-Rhesus MRPL39 Antibody (MO-AB-04483W) |
CBMOAB-87400FYA | Mouse Anti-Zebrafish mrpl39 Antibody (CBMOAB-87400FYA) |
MO-AB-59349W | Mouse Anti-Marmoset MRPL39 Antibody (MO-AB-59349W) |
CBMOAB-06824HCB | Mouse Anti-C. elegans MRPL39 Antibody (CBMOAB-06824HCB) |
MO-AB-16012R | Mouse Anti-Cattle MRPL39 Antibody (MO-AB-16012R) |
MO-AB-15597W | Mouse Anti-Chimpanzee MRPL39 Antibody (MO-AB-15597W) |
CBMOAB-51732FYA | Mouse Anti-Rhesus MRPL39 Antibody (CBMOAB-51732FYA) |
CBMOAB-24721FYA | Mouse Anti-D. melanogaster Mrpl39 Antibody (CBMOAB-24721FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry