Mouse Anti-MRPS16 Antibody (CBMOAB-02427CR)
Cat: CBMOAB-02427CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-02427CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO02427CR | 100 µg | ||
CBMOAB-06844HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO06844HB | 100 µg | ||
CBMOAB-24753FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO24753FYA | 100 µg | ||
CBMOAB-87435FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87435FYA | 100 µg | ||
MO-AB-05317H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05317C | 100 µg | ||
MO-AB-16047R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16047R | 100 µg | ||
MO-AB-26064W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26064W | 100 µg | ||
MO-AB-27228H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27228C | 100 µg | ||
MO-AB-35147W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35147W | 100 µg | ||
MO-AB-59368W | Monoclonal | Marmoset | WB, ELISA | MO59368W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
Clone | MO02427CR |
Specificity | This antibody binds to Yeast MRPS16. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described. |
Product Overview | Mouse Anti-Yeast MRPS16 Antibody is a mouse antibody against MRPS16. It can be used for MRPS16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 37S ribosomal protein S16, mitochondrial; MRPS16; YPL013C |
UniProt ID | Q02608 |
Protein Refseq | The length of the protein is 121 amino acids long. The sequence is show below: MTCGLVRIRLARFGRKNSPVYNIVVANSRKARDAKPIEVLGTYVPVPSPVTKRELKRGVVPIKDVKLDFDRTKYWIGVGAQPSETVTKLLRKAGILNDAWATSKNSNVNRKVVFERMETLE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry