Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Yeast OCA2 Antibody (CBMOAB-00051CR)


Cat: CBMOAB-00051CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00051CR
SpecificityThis antibody binds to Yeast OCA2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for normal growth in the presence of linoleic acid hydroperoxide (LoaOOH).
Product OverviewMouse Anti-Yeast OCA2 (clone MO00051CR) Antibody (CBMOAB-00051CR) is a mouse antibody against OCA2. It can be used for OCA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTyrosine-protein phosphatase-like protein OCA2; Oxidant-induced cell-cycle arrest protein 2; OCA2; YNL056W
UniProt IDP53949
Protein RefseqThe length of the protein is 197 amino acids long. The sequence is show below: MKYIPPLNFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYIGDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGICQEYGLFSGGMKDGVDLEFITMFETNLKIPRNVIPGFAKHCLYLNELEAAEGSDDESGSESILTAKQPI.
For Research Use Only | Not For Clinical Use.

Online Inquiry