Mouse Anti-Yeast PAF1 Antibody (CBMOAB-00055CR)
Cat: CBMOAB-00055CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast |
Clone | MO00055CR |
Specificity | This antibody binds to Yeast PAF1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The PAF1 complex is a multifunctional complex. Involved in transcription initiation via genetic interactions with TATA-binding proteins. Involved in elongation. It regulates 3'-end formation of snR47 by modulating the recruitment or stable association of NRD1 and NAB3 with RNA polymerase II. Also has a role in transcription-coupled histone modification. Required for activation of the RAD6/UBC2-BRE1 ubiquitin ligase complex, which ubiquitinates histone H2B to form H2BK123ub1. Also required for the methylation of histone H3 by the COMPASS complex to form H3K4me, by SET2 to form H3K36me, and by DOT1 to form H3K79me. RNA polymerase II associated protein important for transcription of a subset of genes. Required for both positive and negative regulation. Negatively regulates MAK16 expression. Also required for efficient CLN2 transcription in late G1 and may be involved in transcription of galactose-inducible genes. |
Product Overview | Mouse Anti-Yeast PAF1 Antibody is a mouse antibody against PAF1. It can be used for PAF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | RNA polymerase II-associated protein 1; Protein PAF1; PAF1; YBR279W |
UniProt ID | P38351 |
Protein Refseq | The length of the protein is 445 amino acids long. The sequence is show below: MSKKQEYIAPIKYQNSLPVPQLPPKLLVYPESPETNADSSQLINSLYIKTNVTNLIQQDEDLGMPVDLMKFPGLLNKLDSKLLYGFDNVKLDKDDRILLRDPRIDRLTKTDISKVTFLRRTEYVSNTIAAHDNTSLKRKRRLDDGDSDDENLDVNHIISRVEGTFNKTDKWQHPVKKGVKMVKKWDLLPDTASMDQVYFILKFMGSASLDTKEKKSLNTGIFRPVELEEDEWISMYATDHKDSAILENELEKGMDEMDDDSHEGKIYKFKRIRDYDMKQVAEKPMTELAIRLNDKDGIAYYKPLRSKIELRRRRVNDIIKPLVKEHDIDQLNVTLRNPSTKEANIRDKLRMKFDPINFATVDEEDDEDEEQPEDVKKESEGDSKTEGSEQEGENEKDEEIKQEKENEQDEENKQDENRAADTPETSDAVHTEQKPEEEKETLQEE. |
See other products for " PAF1 "
CBMOAB-08123HCB | Mouse Anti-C. elegans PAF1 Antibody (CBMOAB-08123HCB) |
MO-AB-05978H | Mouse Anti-Frog paf1 Antibody (MO-AB-05978H) |
CBMOAB-38042FYC | Mouse Anti-Arabidopsis PAF1 Antibody (CBMOAB-38042FYC) |
MO-AB-60906W | Mouse Anti-Marmoset PAF1 Antibody (MO-AB-60906W) |
MO-AB-13098W | Mouse Anti-Chimpanzee PAF1 Antibody (MO-AB-13098W) |
CBMOAB-88463FYB | Mouse Anti-Rice PAF1 Antibody (CBMOAB-88463FYB) |
MO-AB-17462R | Mouse Anti-Cattle PAF1 Antibody (MO-AB-17462R) |
CBMOAB-53757FYA | Mouse Anti-Rhesus PAF1 Antibody (CBMOAB-53757FYA) |
CBMOAB-91264FYA | Mouse Anti-Zebrafish paf1 Antibody (CBMOAB-91264FYA) |
MO-DKB-03488W | Rabbit Anti-PAF1 (Center) Antibody (Cat MO-DKB-03488W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry