AibGenesis™ Mouse Anti-PMP1 Antibody (CBMOAB-03020CR)


Cat: CBMOAB-03020CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-03020CR Monoclonal Yeast, C. elegans (Caenorhabditis elegans) WB, ELISA MO03020CR 100 µg
Inquiry
CBMOAB-08503HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO08503HB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, C. elegans (Caenorhabditis elegans)
CloneMO03020CR
SpecificityThis antibody binds to Yeast PMP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPresent with 124000 molecules/cell in log phase SD medium. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast PMP1 Antibody is a mouse antibody against PMP1. It can be used for PMP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPlasma membrane ATPase proteolipid 1; PMP1; YCR024C-A
UniProt IDP32903
Protein RefseqThe length of the protein is 40 amino acids long. The sequence is show below: MTLPGGVILVFILVGLACIAIIATIIYRKWQARQRGLQRF.
For Research Use Only | Not For Clinical Use.
Online Inquiry