AibGenesis™ Mouse Anti-SDH6 Antibody (CBMOAB-03833CR)


Cat: CBMOAB-03833CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-03833CR Monoclonal Yeast, A. thaliana (Arabidopsis thaliana) WB, ELISA MO03833CR 100 µg
Inquiry
MO-DKB-01967W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, A. thaliana (Arabidopsis thaliana)
CloneMO03833CR
SpecificityThis antibody binds to Yeast SDH6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDH2 of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. Acts together with SDHAF3 (SDH7). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast SDH6 Antibody is a mouse antibody against SDH6. It can be used for SDH6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuccinate dehydrogenase assembly factor 1, mitochondrial; SDH assembly factor 1; SDHAF1; SDH6; YDR379C-A
UniProt IDQ3E785
Protein RefseqThe length of the protein is 79 amino acids long. The sequence is show below: MPKRLSGLQKEVLHLYRASIRTAHTKPKENQVNFVNYIHEEFGKYRNLPRKDFTTIEHLLRVGNKKIATFSHPELTNIH.
For Research Use Only | Not For Clinical Use.
Online Inquiry