AibGenesis™ Mouse Anti-SEM1 Antibody (CBMOAB-03889CR)
Cat: CBMOAB-03889CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-03889CR | Monoclonal | Yeast, Cattle (Bos taurus), Cucumber (Cucumis sativus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus) | WB, ELISA | MO03889CR | 100 µg | ||
| MO-AB-03084W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO03084W | 100 µg | ||
| MO-AB-07501H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07501C | 100 µg | ||
| MO-AB-19921R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19921R | 100 µg | ||
| MO-AB-28662W | Monoclonal | Cucumber (Cucumis sativus) | WB, ELISA | MO28662W | 100 µg | ||
| MO-AB-28916H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28916C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, Cattle (Bos taurus), Cucumber (Cucumis sativus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus) |
| Clone | MO03889CR |
| Specificity | This antibody binds to Yeast SEM1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Versatile protein that might stabilize multiple protein complexes involved in diverse pathways. Subunit of the 26S proteasome which plays a role in ubiquitin-dependent proteolysis. Associates also with the TREX-2 complex that is required for transcription-coupled mRNA export, and the COP9 signalosome, which is involved in deneddylation. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast SEM1 Antibody is a mouse antibody against SEM1. It can be used for SEM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 26S proteasome complex subunit SEM1; SEM1; DSH1; YDR363W-A |
| UniProt ID | O94742 |
| Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry