Mouse Anti-Yeast TAF13 Antibody (CBMOAB-04373CR)
Cat: CBMOAB-04373CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast |
Clone | MO04373CR |
Specificity | This antibody binds to Yeast TAF13. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. |
Product Overview | Mouse Anti-Yeast TAF13 Antibody is a mouse antibody against TAF13. It can be used for TAF13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Transcription initiation factor TFIID subunit 13; Function unknown 81 protein; TAFII-19; TAFII19; TBP-associated factor 13; TBP-associated factor 19 kDa; TAF13; FUN81 TAF19; YML098W |
UniProt ID | P11747 |
Protein Refseq | The length of the protein is 167 amino acids long. The sequence is show below: MSRKLKKTNLFNKDVSSLLYAYGDVPQPLQATVQCLDELVSGYLVDVCTNAFHTAQNSQRNKLRLEDFKFALRKDPIKLGRAEELIATNKLITEAKKQFNETDNQNSLKRYREEDEEGDEMEEDEDEQQVTDDDEEAAGRNSAKQSTDSKATKIRKQGPKNLKKTKK. |
See other products for " TAF13 "
MO-AB-13378Y | Mouse Anti-O. mykiss TAF13 Antibody (MO-AB-13378Y) |
CBMOAB-44777FYC | Mouse Anti-Arabidopsis TAF13 Antibody (CBMOAB-44777FYC) |
MO-AB-29335H | Mouse Anti-Rat Taf13 Antibody (MO-AB-29335H) |
MO-AB-08241H | Mouse Anti-Frog taf13 Antibody (MO-AB-08241H) |
MO-AB-11358W | Mouse Anti-Chimpanzee TAF13 Antibody (MO-AB-11358W) |
CBMOAB-32535FYA | Mouse Anti-D. melanogaster Taf13 Antibody (CBMOAB-32535FYA) |
MO-AB-65799W | Mouse Anti-Marmoset TAF13 Antibody (MO-AB-65799W) |
CBMOAB-11876HCB | Mouse Anti-C. elegans TAF13 Antibody (CBMOAB-11876HCB) |
MO-AB-21231R | Mouse Anti-Cattle TAF13 Antibody (MO-AB-21231R) |
MO-AB-06404W | Mouse Anti-Rhesus TAF13 Antibody (MO-AB-06404W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry